PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf01078g00028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 320aa    MW: 35957 Da    PI: 4.7653
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf01078g00028.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.72e-082662992255
                               SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                  Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                +yp++ e+  LA+++gL+ +q+ +WF N+R ++
  Niben101Scf01078g00028.1 266 WPYPTEGEKICLAESTGLDPKQINNWFINQRKRH 299
                               58*****************************885 PP

2ELK40.27e-14219240122
                       ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                               E+K+ L+rKYsgy++sLkqEF+
  Niben101Scf01078g00028.1 219 EIKDKLMRKYSGYISSLKQEFC 240
                               89*******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.5E-1478122IPR005540KNOX1
PfamPF037902.3E-1880116IPR005540KNOX1
SMARTSM012567.9E-21127178IPR005541KNOX2
PfamPF037912.8E-22132177IPR005541KNOX2
PfamPF037894.0E-11219240IPR005539ELK domain
PROSITE profilePS5121310.964219239IPR005539ELK domain
SMARTSM011882.4E-7219240IPR005539ELK domain
PROSITE profilePS5007111.612239302IPR001356Homeobox domain
SuperFamilySSF466894.28E-19241311IPR009057Homeodomain-like
SMARTSM003894.1E-11241306IPR001356Homeobox domain
CDDcd000866.51E-13242303No hitNo description
Gene3DG3DSA:1.10.10.604.7E-27244304IPR009057Homeodomain-like
PfamPF059206.2E-16259298IPR008422Homeobox KN domain
PROSITE patternPS000270277300IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0010094Biological Processspecification of carpel identity
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MEEMYEFGSS SSAVYSVDDH LQPPYFGSAP AFCDELLPMG FGSGNMSSVC SESSAANSVV  60
DKSGMSSSNL QLQDHHETNI RAKISSHPLY PKLLRTYIDC HKVGAPSEIV DMLDNINIVH  120
ENDLYRRSNR LTDDSELDDF MGTYCDVLAK FKSDLERPFN EATNFLNDIE TQLTNLCTAP  180
ATTTSNISDE GAAGLEEEAA ADTSGGGGNT NDMCRPEKEI KDKLMRKYSG YISSLKQEFC  240
KKNKKGKLPR EATQILLNWW TTNYKWPYPT EGEKICLAES TGLDPKQINN WFINQRKRHW  300
KPSENMQYAV MENLYGHSSD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009772710.10.0PREDICTED: homeobox protein knotted-1-like 2
SwissprotP466401e-89KNAT2_ARATH; Homeobox protein knotted-1-like 2
TrEMBLQ9SXV20.0Q9SXV2_TOBAC; Homeobox 9
STRINGVIT_17s0000g08710.t013e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.13e-86KNOTTED-like from Arabidopsis thaliana 2